General Information of the Protein
| Protein ID |
PT03418
|
||||
|---|---|---|---|---|---|
| Protein Name |
Protein Tat
|
||||
| Secondarily Protein Name |
Transactivating regulatory protein
|
||||
| Gene Name |
TAT
|
||||
| Sequence |
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAPQGSQTHQVSLSKQPTSQSRGDPTGPKE
Show/Hide
|
||||
| Organism |
Human immunodeficiency virus type 1 group M subtype B (isolate PCV12), HIV-1
|
||||
| Protein Classification |
Transcription factor
|
||||
| Function |
Transcriptional activator that increases RNA Pol II processivity, thereby increasing the level of full-length viral transcripts. Recognizes a hairpin structure at the 5'-LTR of the nascent viral mRNAs referred to as the transactivation responsive RNA element (TAR) and recruits the cyclin T1-CDK9 complex (P-TEFb complex) that will in turn hyperphosphorylate the RNA polymerase II to allow efficient elongation. The CDK9 component of P-TEFb and other Tat-activated kinases hyperphosphorylate the C-terminus of RNA Pol II that becomes stabilized and much more processive. Other factors such as HTATSF1/Tat-SF1, SUPT5H/SPT5, and HTATIP2 are also important for Tat's function. Besides its effect on RNA Pol II processivity, Tat induces chromatin remodeling of proviral genes by recruiting the histone acetyltransferases (HATs) CREBBP, EP300 and PCAF to the chromatin. This also contributes to the increase in proviral transcription rate, especially when the provirus integrates in transcriptionally silent region of the host genome. To ensure maximal activation of the LTR, Tat mediates nuclear translocation of NF-kappa-B by interacting with host RELA. Through its interaction with host TBP, Tat may also modulate transcription initiation. Tat can reactivate a latently infected cell by penetrating in it and transactivating its LTR promoter. In the cytoplasm, Tat is thought to act as a translational activator of HIV-1 mRNAs.
Show/Hide
|
||||
| Uniprot ID | |||||
| Subcellular Location |
Host nucleus
Host nucleolus
Host cytoplasm
Secreted
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000015 , SW480
Biochemical Assays
| Compound ID | Compound Name | Compound Formula | |
| CP0212782 |
7-Chloro-5-(1H-pyrrol-2-yl)-1,3-dihydro-benzo[e][1,4]diazepin-2-one
Show/Hide
|
C13H10ClN3O
|
1 |
| 1 | IC50 = 4000 nM | ||
|---|---|---|---|
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT04279 | Protein Tat | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2), HIV-1 | |
|---|---|---|---|