General Information of the Protein
| Protein ID |
PT03153
|
||||
|---|---|---|---|---|---|
| Protein Name |
Urea transporter 1
|
||||
| Secondarily Protein Name |
Solute carrier family 14 member 1
Urea transporter B
Urea transporter
erythrocyte
|
||||
| Gene Name |
SLC14A1
|
||||
| Sequence |
MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWWLIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTKNPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL
Show/Hide
|
||||
| Organism |
Mus musculus, Mouse
|
||||
| Protein Classification |
Transporter
>
Electrochemical transporter
>
SLC superfamily of solute carriers
>
SLC14 family of facilitative urea transporters
|
||||
| Function |
Mediates the transport of urea driven by a concentration gradient across the cell membranes of erythrocytes and the renal inner medullary collecting duct which is critical to the urinary concentrating mechanism (PubMed:11792714). Facilitates water transport in erythrocytes (PubMed:12133842).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
Basolateral cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000031 , MDCK
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT04648 | Urea transporter 1 | Rattus norvegicus, Rat | |
|---|---|---|---|