General Information of the Protein
Protein ID |
PT02925
|
||||
---|---|---|---|---|---|
Protein Name |
Adrenocorticotropic hormone receptor
|
||||
Secondarily Protein Name |
Adrenocorticotropin receptor
Melanocortin receptor 2
|
||||
Gene Name |
MC2R
|
||||
Secondarily Gene Name |
ACTHR
|
||||
Sequence |
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Melanocortin receptor
|
||||
Function |
Receptor for corticotropin (ACTH). This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase (cAMP).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Clinical Information about the Protein
Target 1 ( Melanocortin receptor 2 (MC2R) )
Target Type | Successful Target |
---|
Similar Protein(s) and Bioactivity Statistics
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT02992 | Adrenocorticotropic hormone receptor | Mus musculus, Mouse |
---|