General Information of the Protein
| Protein ID |
PT02010
|
||||
|---|---|---|---|---|---|
| Protein Name |
Hydroxycarboxylic acid receptor 3
|
||||
| Secondarily Protein Name |
G-protein coupled receptor 109B
G-protein coupled receptor HM74
G-protein coupled receptor HM74B
Niacin receptor 2
Nicotinic acid receptor 2
|
||||
| Gene Name |
HCAR3
|
||||
| Secondarily Gene Name |
GPR109B
HCA3
HM74B
NIACR2
|
||||
| Sequence |
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Carboxylic acid receptor
>
Hydroxycarboxylic acid receptor
|
||||
| Function |
Receptor for 3-OH-octanoid acid mediates a negative feedback regulation of adipocyte lipolysis to counteract prolipolytic influences under conditions of physiological or pathological increases in beta-oxidation rates. Acts as a low affinity receptor for nicotinic acid. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000026 , CHO-K1
Cell Line ID: CL000011 , CHO
Clinical Information about the Protein
Target 1 ( Hydroxycarboxylic acid receptor 3 (HCAR3) )
| Target Type | Clinical trial Target | ||||
|---|---|---|---|---|---|