General Information of the Protein
| Protein ID |
PT01671
|
||||
|---|---|---|---|---|---|
| Protein Name |
Cyclin-dependent kinase 6
|
||||
| Secondarily Protein Name |
Cell division protein kinase 6
Serine/threonine-protein kinase PLSTIRE
|
||||
| Gene Name |
CDK6
|
||||
| Secondarily Gene Name |
CDKN6
|
||||
| Sequence |
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Kinase
>
Protein Kinase
>
CMGC protein kinase group
|
||||
| Function |
Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation; promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation; prevents cell proliferation and negatively regulates cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans. May play a role in the centrosome organization during the cell cycle phases (PubMed:23918663).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Cytoplasm
Nucleus
Cell projection
Ruffle
Cytoplasm
Cytoskeleton
Microtubule organizing center
Centrosome
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000013 , Sf9
Biochemical Assays
| Compound ID | Compound Name | Compound Formula | |
| CP0001256 |
Abemaciclib
Show/Hide
|
C27H32F2N8
|
3 |
| 1 | IC50 = 1.9 nM | ||
|---|---|---|---|
| 2 | IC50 = 5 nM | ||
| 3 | IC50 = 10 nM | ||
Clinical Information about the Protein
Target 1 ( Cyclin-dependent kinase 6 (CDK6) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 5 Target-related Diseases | 5 | |||
| 1 | Psoriasis vulgaris [ICD-11: EA90] | ||||
| 2 | Breast cancer [ICD-11: 2C60-2C65] | ||||
| 3 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| 4 | Small-cell lung cancer [ICD-11: 2C25.Y] | ||||
| 5 | Retinoblastoma [ICD-11: 2D02.2] | ||||
| Approved Drug(s) | 4 Approved Drugs | 4 | |||
| 1 | Apremilast | Approved | |||
| 2 | LY2835219 | Approved | |||
| 3 | Palbociclib | Approved | |||
| 4 | Trilaciclib | Approved | |||
| Clinical Trial Drug(s) | 3 Clinical Trial Drugs | 3 | |||
| 1 | LEE011 | Phase 3 | |||
| 2 | G1T38 | Phase 2 | |||
| 3 | FN-1501 | Phase 1 | |||
| Discontinued Drug(s) | 1 Discontinued Drug | 1 | |||
| 1 | PD-0183812 | Terminated | |||