General Information of the Protein
| Protein ID |
PT01234
|
||||
|---|---|---|---|---|---|
| Protein Name |
Macrophage migration inhibitory factor
|
||||
| Secondarily Protein Name |
Glycosylation-inhibiting factor
L-dopachrome isomerase
L-dopachrome tautomerase
Phenylpyruvate tautomerase
|
||||
| Gene Name |
MIF
|
||||
| Secondarily Gene Name |
GLIF
MMIF
|
||||
| Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
|
||||
| Function |
Pro-inflammatory cytokine involved in the innate immune response to bacterial pathogens (PubMed:15908412, PubMed:17443469, PubMed:23776208). The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense (PubMed:15908412, PubMed:17443469, PubMed:23776208). Counteracts the anti-inflammatory activity of glucocorticoids (PubMed:15908412, PubMed:17443469, PubMed:23776208). Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known (PubMed:11439086, PubMed:17526494). It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (PubMed:11439086, PubMed:17526494).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Secreted
Cytoplasm
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000001 , Jurkat
Cell Line ID: CL000040 , THP-1
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Macrophage migration inhibitory factor (MIF) )
| Target Type | Clinical trial Target | ||||
|---|---|---|---|---|---|
| Disease | 2 Target-related Diseases | 2 | |||
| 1 | Thrombocytopenia [ICD-11: 3B64] | ||||
| 2 | Autoimmune disease [ICD-11: 4A40-4A45] | ||||
| Approved Drug(s) | 1 Approved Drug | 1 | |||
| 1 | 3,4-Dihydroxycinnamic Acid | Phase 4 | |||
| Investigative Drug(s) | 1 Investigative Drug | 1 | |||
| 1 | NAPQI | Investigative | |||