Protein Information

General Information of the Protein

Protein ID	PT01108
Protein Name	11-beta-hydroxysteroid dehydrogenase type 2
Secondarily Protein Name	11-beta-hydroxysteroid dehydrogenase type II Corticosteroid 11-beta-dehydrogenase isozyme 2 NAD-dependent 11-beta-hydroxysteroid dehydrogenase Short chain dehydrogenase/reductase family 9C member 3
Gene Name	HSD11B2
Secondarily Gene Name	HSD11K SDR9C3
Sequence	MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR Show/Hide
Organism	Homo sapiens, Human
Protein Classification	Enzyme
Function	Catalyzes the conversion of biologically active 11beta-hydroxyglucocorticoids (11beta-hydroxysteroid) such as cortisol, to inactive 11-ketoglucocorticoids (11-oxosteroid) such as cortisone, in the presence of NAD(+) (PubMed:7859916, PubMed:8538347, PubMed:10497248, PubMed:22796344, PubMed:27927697, PubMed:30902677, PubMed:33387577, PubMed:12788846, PubMed:17314322). Functions as a dehydrogenase (oxidase), thereby decreasing the concentration of active glucocorticoids, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids (PubMed:7859916, PubMed:10497248, PubMed:33387577, PubMed:12788846, PubMed:17314322). Plays an important role in maintaining glucocorticoids balance during preimplantation and protects the fetus from excessive maternal corticosterone exposure (By similarity). Catalyzes the oxidation of 11beta-hydroxytestosterone (11beta,17beta-dihydroxyandrost-4-ene-3-one) to 11-ketotestosterone (17beta-hydroxyandrost-4-ene-3,11-dione), a major bioactive androgen (PubMed:22796344, PubMed:27927697). Catalyzes the conversion of 11beta-hydroxyandrostenedione (11beta-hydroxyandrost-4-ene-3,17-dione) to 11-ketoandrostenedione (androst-4-ene-3,11,17-trione), which can be further metabolized to 11-ketotestosterone (PubMed:27927697). Converts 7-beta-25-dihydroxycholesterol to 7-oxo-25-hydroxycholesterol in vitro (PubMed:30902677). 7-beta-25-dihydroxycholesterol (not 7-oxo-25-hydroxycholesterol) acts as a ligand for the G-protein-coupled receptor (GPCR) Epstein-Barr virus-induced gene 2 (EBI2) and may thereby regulate immune cell migration (PubMed:30902677). May protect ovulating oocytes and fertilizing spermatozoa from the adverse effects of cortisol (By similarity). Show/Hide
Uniprot ID	Primary ID: P80365 Secondarily ID: A7LB28 C5HTY7 Q13194 Q6P2G9 Q8N439 Q96QN8 Q99887 Q9UC50 Q9UC51 Q9UCW5 Q9UCW6 Q9UCW7 Q9UCW8 Show/Hide
Ensembl ID	ENSG00000176387
HGNC ID	HGNC:5209
Subcellular Location	Microsome Endoplasmic reticulum

Map of Molecular Bioactivity Related to the Protein

Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity

Table of Molecular Bioactivities Related to the Protein

Cell Line ID: CL000026 , CHO-K1

Cell Line Info

Compound ID	Compound Name	Compound Formula
CP0221520 Compound Info	3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocine Show/Hide	C21H35N3	1
1	IC50 = 180 nM Bioactivity Info	TI LI LO TS
CP0456289 Compound Info	5-(4-(5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocin-3-yl)bicyclo[2.2.2]octan-1-yl)pentan-2-ol Show/Hide	C21H35N3O	1
1	IC50 = 290 nM Bioactivity Info	TI LI LO TS
CP0303155 Compound Info	3-(4-((4-chlorophenoxy)methyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C25H25ClF3N3O	1
1	IC50 = 460 nM Bioactivity Info	TI LI LO TS
CP0050383 Compound Info	4-methyl-3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3	1
1	IC50 = 1300 nM Bioactivity Info	TI LI LO TS
CP0474208 Compound Info	3-(4-(4-fluoropentyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H29F4N3	1
1	IC50 = 1300 nM Bioactivity Info	TI LI LO TS
CP0459201 Compound Info	4-methyl-3-(4-(2-(2,2,2-trifluoroethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H25F6N3O2S	1
1	IC50 = 1600 nM Bioactivity Info	TI LI LO TS
CP0494395 Compound Info	3-(4-(4-methoxybutyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O	1
1	IC50 = 4000 nM Bioactivity Info	TI LI LO TS
CP0499209 Compound Info	5-(4-(4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazol-3-yl)bicyclo[2.2.2]octan-1-yl)pentan-2-one Show/Hide	C23H28F3N3O	1
1	IC50 = 4000 nM Bioactivity Info	TI LI LO TS
CP0456290 Compound Info	5-(4-(4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazol-3-yl)bicyclo[2.2.2]octan-1-yl)pentan-2-ol Show/Hide	C23H30F3N3O	1
1	IC50 > 1000 nM Bioactivity Info	TI LI LO TS
CP0247593 Compound Info	3-Adamantan-1-yl-4-methyl-5-phenyl-4H-[1,2,4]triazole Show/Hide	C19H23N3	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0087093 Compound Info	3-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H28F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0100579 Compound Info	3-(4-(ethylsulfonylmethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C21H26F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0438227 Compound Info	4-methyl-3-(4-(2-(methylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C21H26F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0438228 Compound Info	N-[[4-[4-methyl-5-[2-(trifluoromethyl)phenyl]-1,2,4-triazol-3-yl]-1-bicyclo[2.2.2]octanyl]methyl]ethanesulfonamide Show/Hide	C21H27F3N4O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0438231 Compound Info	3-(2-chlorophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28ClN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0456287 Compound Info	3-(4-(2-(ethylsulfinyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H28F3N3OS	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0456288 Compound Info	3-(2-bromophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28BrN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459166 Compound Info	3-(4-chlorophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28ClN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459200 Compound Info	4-methyl-3-(4-((4-(methylsulfonyl)phenoxy)methyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C26H28F3N3O3S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459202 Compound Info	3-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-o-tolyl-4H-1,2,4-triazole Show/Hide	C22H31N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0465191 Compound Info	3-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-fluorophenyl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28FN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0465193 Compound Info	3-(4-(4,4-difluoropentyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H28F5N3	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0467657 Compound Info	3-(4-(3-(ethylsulfonyl)propyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0467659 Compound Info	3-(4-(2-(isopropylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0467674 Compound Info	N-[[4-[4-methyl-5-[2-(trifluoromethyl)phenyl]-1,2,4-triazol-3-yl]-1-bicyclo[2.2.2]octanyl]methyl]propane-1-sulfonamide Show/Hide	C22H29F3N4O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0474206 Compound Info	3-(4-(2-(tert-butylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C24H32F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0478360 Compound Info	3-(4-(2-(4-fluorophenylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C26H27F4N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0478665 Compound Info	3-(4-(2-(ethylthio)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H28F3N3S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0479033 Compound Info	N-[[4-[4-methyl-5-[2-(trifluoromethyl)phenyl]-1,2,4-triazol-3-yl]-1-bicyclo[2.2.2]octanyl]methyl]methanesulfonamide Show/Hide	C20H25F3N4O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0480447 Compound Info	3-chloro-4-(5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazol-3-yl)phenol Show/Hide	C21H28ClN3O3S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0480452 Compound Info	3-(4-(ethoxymethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C21H26F3N3O	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0488470 Compound Info	4-methyl-3-(4-(2-(propylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0488471 Compound Info	4-methyl-3-(2-(trifluoromethyl)phenyl)-5-(4-(2-(trifluoromethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4H-1,2,4-triazole Show/Hide	C21H23F6N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0494394 Compound Info	4-methyl-3-(4-(2-(phenylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C26H28F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0500109 Compound Info	3-(3-chlorophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28ClN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0506643 Compound Info	3-(4-(4-(ethylsulfonyl)butyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C24H32F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS

Cell Line ID: CL000011 , CHO

Cell Line Info

Cell Line ID: CL000006 , HEK293

Cell Line Info

Cell Line ID: CL000065 , HEK293-EBNA

Cell Line Info

Biochemical Assays

Compound ID	Compound Name	Compound Formula
CP0052039 Compound Info	18beta-glycyrrhetic acid Show/Hide	C30H46O4	1
1	IC50 = 1.22 nM
CP0221520 Compound Info	3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocine Show/Hide	C21H35N3	1
1	IC50 = 183 nM
CP0247593 Compound Info	3-Adamantan-1-yl-4-methyl-5-phenyl-4H-[1,2,4]triazole Show/Hide	C19H23N3	1
1	IC50 > 4000 nM
CP0036916 Compound Info	2-(2-(3-chloro-2-methylphenylsulfonamido)thiazol-4-yl)-N,N-diethylacetamide Show/Hide	C16H20ClN3O3S2	1
1	IC50 > 10000 nM

Clinical Information about the Protein

Target 1 ( Corticosteroid 11-beta-dehydrogenase 2 (HSD11B2) )

Target Type	Clinical trial Target

Cite

About MolBiC

Correspondence

Prof. Feng ZHU

Prof. Leo, Lianyi Han