General Information of the Protein
Protein ID |
PT00841
|
||||
---|---|---|---|---|---|
Protein Name |
Carbonic anhydrase 12
|
||||
Secondarily Protein Name |
Carbonate dehydratase XII
Carbonic anhydrase XII
Tumor antigen HOM-RCC-3.1.3
|
||||
Gene Name |
CA12
|
||||
Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Show/Hide
|
||||
Organism |
Homo sapiens, Human
|
||||
Protein Classification |
Enzyme
>
Lyase
|
||||
Function |
Reversible hydration of carbon dioxide.
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
HGNC ID | |||||
Subcellular Location |
Membrane
Cell membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000013 , Sf9
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Carbonic anhydrase XII (CA-XII) )
Target Type | Successful Target | ||||
---|---|---|---|---|---|
Disease | 4 Target-related Diseases | 4 | |||
1 | Seborrhoeic dermatitis [ICD-11: EA81] | ||||
2 | Bacterial infection [ICD-11: 1A00-1C4Z] | ||||
3 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
4 | Breast cancer [ICD-11: 2C60-2C65] | ||||
Approved Drug(s) | 2 Approved Drugs | 2 | |||
1 | Salicyclic acid | Approved | |||
2 | Sulfamylon | Approved | |||
Clinical Trial Drug(s) | 2 Clinical Trial Drugs | 2 | |||
1 | Curcumin | Phase 3 | |||
2 | Coumate | Phase 2 | |||
Investigative Drug(s) | 1 Investigative Drug | 1 | |||
1 | CL-5343 | Investigative |