General Information of the Protein
| Protein ID |
PT00841
|
||||
|---|---|---|---|---|---|
| Protein Name |
Carbonic anhydrase 12
|
||||
| Secondarily Protein Name |
Carbonate dehydratase XII
Carbonic anhydrase XII
Tumor antigen HOM-RCC-3.1.3
|
||||
| Gene Name |
CA12
|
||||
| Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Lyase
|
||||
| Function |
Reversible hydration of carbon dioxide.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Subcellular Location |
Membrane
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000025 , HEK-293T
Cell Line ID: CL000013 , Sf9
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Carbonic anhydrase XII (CA-XII) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 4 Target-related Diseases | 4 | |||
| 1 | Seborrhoeic dermatitis [ICD-11: EA81] | ||||
| 2 | Bacterial infection [ICD-11: 1A00-1C4Z] | ||||
| 3 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | ||||
| 4 | Breast cancer [ICD-11: 2C60-2C65] | ||||
| Approved Drug(s) | 2 Approved Drugs | 2 | |||
| 1 | Salicyclic acid | Approved | |||
| 2 | Sulfamylon | Approved | |||
| Clinical Trial Drug(s) | 2 Clinical Trial Drugs | 2 | |||
| 1 | Curcumin | Phase 3 | |||
| 2 | Coumate | Phase 2 | |||
| Investigative Drug(s) | 1 Investigative Drug | 1 | |||
| 1 | CL-5343 | Investigative | |||