General Information of the Protein
| Protein ID |
PT00824
|
||||
|---|---|---|---|---|---|
| Protein Name |
Cathepsin K
|
||||
| Secondarily Protein Name |
Cathepsin O
Cathepsin O2
Cathepsin X
|
||||
| Gene Name |
CTSK
|
||||
| Secondarily Gene Name |
CTSO
CTSO2
|
||||
| Sequence |
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Enzyme
>
Protease
>
Cysteine protease
>
Cysteine protease CA clan
>
Cysteine protease C1A family
|
||||
| Function |
Thiol protease involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Involved in the release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen (PubMed:11082042).
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| HGNC ID | |||||
| Subcellular Location |
Lysosome
Secreted
Apical cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000003 , Ramos
Clinical Information about the Protein
Target 1 ( Cathepsin K (CTSK) )
| Target Type | Clinical trial Target | ||||
|---|---|---|---|---|---|
| Disease | 5 Target-related Diseases | 5 | |||
| 1 | Osteoporosis [ICD-11: FB83.0] | ||||
| 2 | Rheumatoid arthritis [ICD-11: FA20] | ||||
| 3 | Bone metastases [ICD-11: 2D50] | ||||
| 4 | Osteoarthritis [ICD-11: FA00-FA05] | ||||
| 5 | Asthma [ICD-11: CA23] | ||||
| Clinical Trial Drug(s) | 2 Clinical Trial Drugs | 2 | |||
| 1 | Odanacatib | Phase 3 | |||
| 2 | VEL-0230 | Phase 1 | |||
| Discontinued Drug(s) | 2 Discontinued Drugs | 2 | |||
| 1 | Balicatib | Discontinued in Phase 2 | |||
| 2 | Relacatib | Discontinued in Phase 2 | |||
| Investigative Drug(s) | 1 Investigative Drug | 1 | |||
| 1 | L-873724 | Investigative | |||
| Preclinical Drug(s) | 1 Preclinical Drug | 1 | |||
| 1 | L-006235-1 | Preclinical | |||
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT02490 | Cathepsin K | Rattus norvegicus, Rat | |
|---|---|---|---|