General Information of the Protein
| Protein ID |
PT00670
|
||||
|---|---|---|---|---|---|
| Protein Name |
Luteinizing hormone/choriogondaotropin receptor
|
||||
| Sequence |
FIIICACYIKIYFAVQNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKAPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFG
Show/Hide
|
||||
| Organism |
Macaca fascicularis, Crab-eating macaque, Cynomolgus monkey
|
||||
| Protein Classification |
Unclassified protein
|
||||
| Uniprot ID | |||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT04434 | Lutropin-choriogonadotropic hormone receptor | Homo sapiens, Human | |
|---|---|---|---|
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT07470 | Lutropin-choriogonadotropic hormone receptor | Mus musculus, Mouse | |
|---|---|---|---|