General Information of the Protein
Protein ID |
PT00670
|
||||
---|---|---|---|---|---|
Protein Name |
Luteinizing hormone/choriogondaotropin receptor
|
||||
Sequence |
FIIICACYIKIYFAVQNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKAPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFG
Show/Hide
|
||||
Organism |
Macaca fascicularis, Crab-eating macaque, Cynomolgus monkey
|
||||
Protein Classification |
Unclassified protein
|
||||
Uniprot ID |
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Similar Protein(s) and Bioactivity Statistics
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT04434 | Lutropin-choriogonadotropic hormone receptor | Homo sapiens, Human |
---|
50% Identity
Protein ID | Protein Name | Protein Organism | |
PT07470 | Lutropin-choriogonadotropic hormone receptor | Mus musculus, Mouse |
---|