General Information of the Protein
| Protein ID |
PT00644
|
||||
|---|---|---|---|---|---|
| Protein Name |
Alpha-1B adrenergic receptor
|
||||
| Gene Name |
I79_008739
|
||||
| Sequence |
MHLSISDWIESGESKTEAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLFSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVIIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLHKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGK
Show/Hide
|
||||
| Organism |
Cricetulus griseus, Chinese hamster, Cricetulus barabensis griseus
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Small molecule receptor (family A GPCR)
>
Monoamine receptor
>
Adrenergic receptor
|
||||
| Uniprot ID | |||||
| Subcellular Location |
Cell membrane
Membrane
Nucleus membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293