General Information of the Protein
| Protein ID |
PT00634
|
||||
|---|---|---|---|---|---|
| Protein Name |
Mas-related G protein-coupled receptor X1
|
||||
| Sequence |
MDPTIPALDTKLTPINRTEATPCYKQTLSFMGLTCIISLVGLTGNAVVLWLLGFRMHKNAFSIYILNLSMADFLFLSGRFIYSLLSFISVPQTISKILYPVTMFSYFAGLSFLSAMSTERCLSVLWPMWYRCRRPTHLSVVLCVLLWVLSLLRSILEWMFCGFLFSGADPVWCQTSDFITVAWLIFLCVVLCVSSLVLVIRILCGSRKMPLTRLYVTILLTVLVFLLCGLPFGVQFFLFFWIHVDWKVLYCHVHLVSMFLAALNSSANPIIYFFVGSFRQRQNRQNLRLVLQRALQDTPEVDEGGGRLPEETLELSGSRLEQ
Show/Hide
|
||||
| Organism |
Macaca mulatta, Rhesus macaque
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
|
||||
| Uniprot ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000035 , NIH 3T3
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT06353 | Mas-related G-protein coupled receptor member X4 | Homo sapiens, Human | |
|---|---|---|---|