General Information of the Protein
| Protein ID |
PT07038
|
||||
|---|---|---|---|---|---|
| Protein Name |
Growth hormone-releasing hormone receptor
|
||||
| Secondarily Protein Name |
Growth hormone-releasing factor receptor
|
||||
| Gene Name |
GHRHR
|
||||
| Sequence |
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRRAFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPLELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLTSMC
Show/Hide
|
||||
| Organism |
Homo sapiens, Human
|
||||
| Protein Classification |
Membrane receptor
>
Family B G protein-coupled receptor
>
Peptide receptor (family B GPCR)
>
Glucagon-like receptor
>
Growth hormone-releasing hormone receptor
|
||||
| Function |
Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| HGNC ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Clinical Information about the Protein
Target 1 ( Growth hormone-releasing hormone receptor (GHRHR) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 2 Target-related Diseases | 2 | |||
| 1 | Pediatric growth disorder [ICD-11: FB86] | ||||
| 2 | Growth hormone deficiency [ICD-11: 5A61.3] | ||||
| Approved Drug(s) | 1 Approved Drug | 1 | |||
| 1 | Sermorelin | Approved | |||
| Discontinued Drug(s) | 2 Discontinued Drugs | 2 | |||
| 1 | Examorelin | Discontinued in Phase 2 | |||
| 2 | L-692429 | Discontinued in Phase 1 | |||