General Information of the Protein
| Protein ID |
PT06391
|
||||
|---|---|---|---|---|---|
| Protein Name |
Trace amine-associated receptor 5
|
||||
| Secondarily Protein Name |
Trimethylamine receptor
|
||||
| Gene Name |
TAAR5
|
||||
| Secondarily Gene Name |
Gm227
|
||||
| Sequence |
MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD
Show/Hide
|
||||
| Organism |
Mus musculus, Mouse
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
|
||||
| Function |
Olfactory receptor specific for trimethylamine, a trace amine enriched in the urine of male mice, playing a role in social behavior. Trimethylamine is present at high concentration in the urine of male mice after puberty and acts as an attractant. This receptor is probably mediated by the G(s)-class of G-proteins which activate adenylate cyclase.
Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Subcellular Location |
Cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293