General Information of the Protein
| Protein ID |
PT03245
|
||||
|---|---|---|---|---|---|
| Protein Name |
Acetylcholine-binding protein
|
||||
| Sequence |
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Show/Hide
|
||||
| Organism |
Lymnaea stagnalis, Great pond snail, Helix stagnalis
|
||||
| Protein Classification |
Unclassified protein
|
||||
| Function |
Binds to acetylcholine. Modulates neuronal synaptic transmission.
Show/Hide
|
||||
| Uniprot ID | |||||
| Subcellular Location |
Synaptic cleft
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000013 , Sf9
Biochemical Assays