General Information of the Protein
Protein ID |
PT03245
|
||||
---|---|---|---|---|---|
Protein Name |
Acetylcholine-binding protein
|
||||
Sequence |
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Show/Hide
|
||||
Organism |
Lymnaea stagnalis, Great pond snail, Helix stagnalis
|
||||
Protein Classification |
Unclassified protein
|
||||
Function |
Binds to acetylcholine. Modulates neuronal synaptic transmission.
Show/Hide
|
||||
Uniprot ID | |||||
Subcellular Location |
Synaptic cleft
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293
Cell Line ID: CL000013 , Sf9
Biochemical Assays