Protein Information

General Information of the Protein

Protein ID	PT03101
Protein Name	Heat shock protein beta-1
Secondarily Protein Name	28 kDa heat shock protein Estrogen-regulated 24 kDa protein Heat shock 27 kDa protein Stress-responsive protein 27
Gene Name	HSPB1
Secondarily Gene Name	HSP27 HSP28
Sequence	MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK Show/Hide
Organism	Homo sapiens, Human
Protein Classification	Other cytosolic protein
Function	Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state (PubMed:10383393, PubMed:20178975). Plays a role in stress resistance and actin organization (PubMed:19166925). Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins (PubMed:23728742). Show/Hide
Uniprot ID	Primary ID: P04792 Secondarily ID: B2R4N8 Q6FI47 Q96C20 Q96EI7 Q9UC31 Q9UC34 Q9UC35 Q9UC36 Show/Hide
Ensembl ID	ENSG00000106211
HGNC ID	HGNC:5246
Subcellular Location	Cytoplasm Nucleus Cytoplasm Cytoskeleton Spindle

Map of Molecular Bioactivity Related to the Protein

Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity

Table of Molecular Bioactivities Related to the Protein

Cell Line ID: CL000293 , HLF

Cell Line Info

Compound ID	Compound Name	Compound Formula
CP0071243 Compound Info	3,4,5,6-Tetrahydro-2H-[1,2']bipyridinyl-4'-carboxylic acid [4'-(cyclopropylmethyl-carbamoyl)-6-methyl-biphenyl-3-yl]-amide Show/Hide	C29H32N4O2	1
1	IC50 = 6 nM Bioactivity Info	TI LI LO TS
CP0019121 Compound Info	N-[3-[4-(cyclopropylmethylcarbamoyl)phenyl]-4-methylphenyl]-2-morpholin-4-ylpyridine-4-carboxamide Show/Hide	C28H30N4O3	1
1	IC50 = 27 nM Bioactivity Info	TI LI LO TS
CP0035439 Compound Info	6-Methyl-biphenyl-3,4'-dicarboxylic acid 3-cyclopropylamide 4'-cyclopropylmethyl-amide Show/Hide	C22H24N2O2	1
1	IC50 = 53 nM Bioactivity Info	TI LI LO TS
CP0018897 Compound Info	1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]urea Show/Hide	C31H37N5O3	1
1	IC50 = 58 nM Bioactivity Info	TI LI LO TS
CP0019162 Compound Info	N-[3-[4-(cyclopropylmethylcarbamoyl)phenyl]-4-methylphenyl]furan-3-carboxamide Show/Hide	C23H22N2O3	1
1	IC50 = 88 nM Bioactivity Info	TI LI LO TS
CP0060853 Compound Info	4-[4-(4-fluorophenyl)-1-(piperidin-4-yl)-1H-imidazol-5-yl]-2-methoxypyrimidine Show/Hide	C19H20FN5O	1
1	IC50 = 160 nM Bioactivity Info	TI LI LO TS

Clinical Information about the Protein

Target 1 ( Heat shock protein 20 (HSP20) )

Target Type	Clinical trial Target

Target 2 ( HSPB1 messenger RNA (HSPB1 mRNA) )