General Information of the Protein
Protein ID |
PT03085
|
||||
---|---|---|---|---|---|
Protein Name |
P2X purinoceptor 4
|
||||
Secondarily Protein Name |
ATP receptor
Purinergic receptor
|
||||
Gene Name |
P2RX4
|
||||
Secondarily Gene Name |
P2x4
|
||||
Sequence |
MAGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCMKKRYYYRDKKYKYVEDYEQGLSGEMNQ
Show/Hide
|
||||
Organism |
Mus musculus, Mouse
|
||||
Protein Classification |
Ion channel
>
Ligand-gated ion channel
>
P2X receptor
|
||||
Function |
ATP-gated nonselective transmembrane cation channel permeable to potassium, sodium and calcium. Activated by extracellularly released ATP, it plays multiple role in immunity and central nervous system physiology (PubMed:26456657, PubMed:35119925). Plays a key role in initial steps of T-cell activation and Ca(2+) microdomain formation (PubMed:35119925). Participates also in basal T-cell activity without TCR/CD3 stimulation (PubMed:35119925). Promotes the differentiation and activation of Th17 cells via expression of retinoic acid-related orphan receptor C/RORC (By similarity). Upon activation, drives microglia motility via the PI3K/Akt pathway (PubMed:17299767). Could also function as an ATP-gated cation channel of lysosomal membranes (PubMed:27477609).
Show/Hide
|
||||
Uniprot ID |
Show/Hide
|
||||
Ensembl ID | |||||
Subcellular Location |
Cell membrane
Lysosome membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Similar Protein(s) and Bioactivity Statistics
90% Identity
Protein ID | Protein Name | Protein Organism | |
PT03084 | P2X purinoceptor 4 | Rattus norvegicus, Rat |
---|