General Information of the Protein
| Protein ID |
PT02681
|
||||
|---|---|---|---|---|---|
| Protein Name |
Neuraminidase
|
||||
| Sequence |
MNPNQKIITIGSICMVVGIISLILQIGNIISIWISHSIQTGNQNHTGICNQGIITYNVVAGQDSTSVILTGNSSLCPIRGWAIHSKDNGIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECTCVNGSCFTIMTDGPSNGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPKDGPGSCGPVSADGANGVKGFSYRYGNGVWIGRTKSDSSRHGFEMIWDPNGWTETDSRFSVRQDVVAMTDRSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPEEETIWTSGSIISFCGVNSDTVDWSWPDGAELPFTIDK
Show/Hide
|
||||
| Organism |
Influenza A virus (strain A/Wilson-Smith/1933 H1N1), Influenza A virus (strain A/WS/1933 H1N1)
|
||||
| Protein Classification |
Enzyme
>
Hydrolase
|
||||
| Function |
Unlike other strains, A/WSN/33 neuraminidase binds and activates plasminogen into plasmin in the vicinity of HA so that activated plasmin cleaves HA rendering the virus infectious.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Subcellular Location |
Virion membrane
Host apical cell membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000031 , MDCK
Biochemical Assays
Clinical Information about the Protein
Target 1 ( Influenza Neuraminidase (Influ NA) )
| Target Type | Successful Target | ||||
|---|---|---|---|---|---|
| Disease | 1 Target-related Disease | 1 | |||
| 1 | Influenza virus infection [ICD-11: 1E30-1E32] | ||||
| Approved Drug(s) | 3 Approved Drugs | 3 | |||
| 1 | Oseltamivir | Approved | |||
| 2 | Peramivir | Approved | |||
| 3 | Zanamivir | Approved | |||
| Clinical Trial Drug(s) | 1 Clinical Trial Drug | 1 | |||
| 1 | CS-8958 | Phase 3 | |||
| Discontinued Drug(s) | 1 Discontinued Drug | 1 | |||
| 1 | BCX-140 | Terminated | |||
Similar Protein(s) and Bioactivity Statistics
90% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT01603 | Neuraminidase | Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) | |
|---|---|---|---|