Protein Information

General Information of the Protein

Protein ID	PT01111
Protein Name	11-beta-hydroxysteroid dehydrogenase type 2
Secondarily Protein Name	Corticosteroid 11-beta-dehydrogenase isozyme 2 NAD-dependent 11-beta-hydroxysteroid dehydrogenase
Gene Name	HSD11B2
Secondarily Gene Name	Hsd11k
Sequence	MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNSPGALELRDLCSPRLKLLQMDLTKAEDISRVLEITKAHTASTGLWGLVNNAGLNIVVADVELSPVATFRKCMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFKTDAVTNVNLWEKRKQLLLANIPRELLQAYGEDYIEHVHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYPGRGLGLMYFIHHYLPEGLRRCFLQNFFINHLLPRALRPGQHGPAPA Show/Hide
Organism	Mus musculus, Mouse
Protein Classification	Enzyme > Oxidoreductase
Function	Catalyzes the conversion of biologically active 11beta-hydroxyglucocorticoids (11beta-hydroxysteroid) such as corticosterone, to inactive 11-ketoglucocorticoids (11-oxosteroid) such as 11-dehydrocorticosterone, in the presence of NAD(+) (Probable) (PubMed:30902677, PubMed:22796344). Functions as a dehydrogenase (oxidase), thereby decreasing the concentration of active glucocorticoids, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids (PubMed:7664690). Plays an important role in maintaining glucocorticoids balance during preimplantation and protects the fetus from excessive maternal corticosterone exposure (PubMed:31600723). Catalyzes the oxidation of 11beta-hydroxytestosterone (11beta,17beta-dihydroxyandrost-4-ene-3-one) to 11-ketotestosterone (17beta-hydroxyandrost-4-ene-3,11-dione), a major bioactive androgen (PubMed:22796344). Catalyzes the conversion of 11beta-hydroxyandrostenedione (11beta-hydroxyandrost-4-ene-3,17-dione) to 11-ketoandrostenedione (androst-4-ene-3,11,17-trione), which can be further metabolized to 11-ketotestosterone (By similarity). Converts 7-beta-25-dihydroxycholesterol to 7-oxo-25-hydroxycholesterol in vitro (By similarity). 7-beta-25-dihydroxycholesterol (not 7-oxo-25-hydroxycholesterol) acts as a ligand for the G-protein-coupled receptor (GPCR) Epstein-Barr virus-induced gene 2 (EBI2) and may thereby regulate immune cell migration (By similarity). Show/Hide
Uniprot ID	Primary ID: P51661 Secondarily ID: Q91WK3 Show/Hide
Ensembl ID	ENSG00000176387
Subcellular Location	Microsome Endoplasmic reticulum

Map of Molecular Bioactivity Related to the Protein

Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity

Table of Molecular Bioactivities Related to the Protein

Cell Line ID: CL000026 , CHO-K1

Cell Line Info

Compound ID	Compound Name	Compound Formula
CP0456289 Compound Info	5-(4-(5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocin-3-yl)bicyclo[2.2.2]octan-1-yl)pentan-2-ol Show/Hide	C21H35N3O	1
1	IC50 = 190 nM Bioactivity Info	TI LI LO TS
CP0221520 Compound Info	3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocine Show/Hide	C21H35N3	1
1	IC50 = 2100 nM Bioactivity Info	TI LI LO TS
CP0050383 Compound Info	4-methyl-3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0087093 Compound Info	3-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H28F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0100579 Compound Info	3-(4-(ethylsulfonylmethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C21H26F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0303155 Compound Info	3-(4-((4-chlorophenoxy)methyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C25H25ClF3N3O	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0438227 Compound Info	4-methyl-3-(4-(2-(methylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C21H26F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0438228 Compound Info	N-[[4-[4-methyl-5-[2-(trifluoromethyl)phenyl]-1,2,4-triazol-3-yl]-1-bicyclo[2.2.2]octanyl]methyl]ethanesulfonamide Show/Hide	C21H27F3N4O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0438231 Compound Info	3-(2-chlorophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28ClN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0456287 Compound Info	3-(4-(2-(ethylsulfinyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H28F3N3OS	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0456288 Compound Info	3-(2-bromophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28BrN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0456290 Compound Info	5-(4-(4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazol-3-yl)bicyclo[2.2.2]octan-1-yl)pentan-2-ol Show/Hide	C23H30F3N3O	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459166 Compound Info	3-(4-chlorophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28ClN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459200 Compound Info	4-methyl-3-(4-((4-(methylsulfonyl)phenoxy)methyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C26H28F3N3O3S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459201 Compound Info	4-methyl-3-(4-(2-(2,2,2-trifluoroethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H25F6N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0459202 Compound Info	3-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-o-tolyl-4H-1,2,4-triazole Show/Hide	C22H31N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0465191 Compound Info	3-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-fluorophenyl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28FN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0465193 Compound Info	3-(4-(4,4-difluoropentyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H28F5N3	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0467657 Compound Info	3-(4-(3-(ethylsulfonyl)propyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0467659 Compound Info	3-(4-(2-(isopropylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0467674 Compound Info	N-[[4-[4-methyl-5-[2-(trifluoromethyl)phenyl]-1,2,4-triazol-3-yl]-1-bicyclo[2.2.2]octanyl]methyl]propane-1-sulfonamide Show/Hide	C22H29F3N4O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0474206 Compound Info	3-(4-(2-(tert-butylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C24H32F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0474208 Compound Info	3-(4-(4-fluoropentyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H29F4N3	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0478360 Compound Info	3-(4-(2-(4-fluorophenylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C26H27F4N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0478665 Compound Info	3-(4-(2-(ethylthio)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C22H28F3N3S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0479033 Compound Info	N-[[4-[4-methyl-5-[2-(trifluoromethyl)phenyl]-1,2,4-triazol-3-yl]-1-bicyclo[2.2.2]octanyl]methyl]methanesulfonamide Show/Hide	C20H25F3N4O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0480447 Compound Info	3-chloro-4-(5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazol-3-yl)phenol Show/Hide	C21H28ClN3O3S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0480452 Compound Info	3-(4-(ethoxymethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C21H26F3N3O	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0488470 Compound Info	4-methyl-3-(4-(2-(propylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0488471 Compound Info	4-methyl-3-(2-(trifluoromethyl)phenyl)-5-(4-(2-(trifluoromethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4H-1,2,4-triazole Show/Hide	C21H23F6N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0494394 Compound Info	4-methyl-3-(4-(2-(phenylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C26H28F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0494395 Compound Info	3-(4-(4-methoxybutyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C23H30F3N3O	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0499209 Compound Info	5-(4-(4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazol-3-yl)bicyclo[2.2.2]octan-1-yl)pentan-2-one Show/Hide	C23H28F3N3O	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0500109 Compound Info	3-(3-chlorophenyl)-5-(4-(2-(ethylsulfonyl)ethyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-4H-1,2,4-triazole Show/Hide	C21H28ClN3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS
CP0506643 Compound Info	3-(4-(4-(ethylsulfonyl)butyl)bicyclo[2.2.2]octan-1-yl)-4-methyl-5-(2-(trifluoromethyl)phenyl)-4H-1,2,4-triazole Show/Hide	C24H32F3N3O2S	1
1	IC50 > 4000 nM Bioactivity Info	TI LI LO TS

Cell Line ID: CL000006 , HEK293

Cell Line Info

Biochemical Assays

Compound ID	Compound Name	Compound Formula
CP0221520 Compound Info	3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocine Show/Hide	C21H35N3	1
1	IC50 = 2100 nM

Cite

About MolBiC

Correspondence

Prof. Feng ZHU

Prof. Leo, Lianyi Han