General Information of the Protein
Protein ID |
PT00694
|
||||
---|---|---|---|---|---|
Protein Name |
Neuropeptide Y-Y2 receptor
|
||||
Sequence |
EYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLKNHVSPGAASDHYHQRR
Show/Hide
|
||||
Organism |
Rattus norvegicus, Rat
|
||||
Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Neuropeptide Y receptor
|
||||
Uniprot ID | |||||
Subcellular Location |
Cell membrane
Membrane
|
Map of Molecular Bioactivity Related to the Protein
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293