General Information of the Protein
| Protein ID |
PT00501
|
||||
|---|---|---|---|---|---|
| Protein Name |
Urotensin-2 receptor
|
||||
| Secondarily Protein Name |
Urotensin II receptor
|
||||
| Gene Name |
UTS2R
|
||||
| Sequence |
MALSPAPLSGFPEPSAAPNASLNRSWASPTEPSSLEDLVATGAIGAVLSAMGVVGVAGNAYTLVVMCRVLHTSASMSVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFSLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRSKGYRKVLALGTWLLALLLALPMMLAIRLVHRGHKSLCLPVWGPRAHRAYLTLLFGTSIVGPGTVIGLLYVRLARAYWLSQRASFTQTRRLPNPKVLYLILGIVLLFWACFLPFWLWQLLAQYRGAQTLTPRTARIVNYLTTCLTYGNSCVNPFLYTLLTKNYREYRRRSLRARSARGPAGARHSLPCRVRFQRGSGHSLCSSSQQATETITLSPAASRAVCA
Show/Hide
|
||||
| Organism |
Felis catus, Cat, Felis silvestris catus
|
||||
| Protein Classification |
Membrane receptor
>
Family A G protein-coupled receptor
>
Peptide receptor (family A GPCR)
>
Short peptide receptor (family A GPCR)
>
Neuropeptide receptor
|
||||
| Function |
High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Show/Hide
|
||||
| Uniprot ID |
Show/Hide
|
||||
| Subcellular Location |
Cell membrane
Membrane
|
||||
Map of Molecular Bioactivity Related to the Protein
|
Map of Molecular Bioactivity Related to the Protein Protein Cell Line Compound Bioactivity Value: <= 0.1 μM > 0.1 μM and <= 10 μM > 10 μM Imprecise Activity |
|
|---|
Table of Molecular Bioactivities Related to the Protein
Cell Line ID: CL000006 , HEK293
Similar Protein(s) and Bioactivity Statistics
50% Identity
| Protein ID | Protein Name | Protein Organism | |
| PT02463 | Urotensin-2 receptor | Homo sapiens, Human | |
|---|---|---|---|